Rabbit Polyclonal Anti-KRT84 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KRT84 Antibody: synthetic peptide directed towards the middle region of human KRT84. Synthetic peptide located within the following region: ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE |
KRT84 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human KRT84 |
KRT84 guinea pig polyclonal antibody, Serum
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of Human basic hair (trichocytic) keratin K84 (formerly also designated hHb4; IAA VGS RPI HCG VRF), coupled to KLH. |
Germany
Japan
United Kingdom
China