Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Hamster |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Hamster |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS |
KCNQ1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KCNQ1 |
Goat Anti-KCNQ1 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EQLTVPRRGPDEGS, from the C-Terminus of the protein sequence according to NP_000209.2; NP_861463.1. |
Rabbit Polyclonal Anti-KV7.1 (KCNQ1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)TYEQLTVPRRGPDEGS, corresponding to amino acid residues 661-676 of human Kv7.1. Intracellular, C-terminus. |
Germany
Japan
United Kingdom
China
