Rabbit polyclonal anti-SUV39H2 antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SUV39H2. |
Rabbit polyclonal anti-SUV39H2 antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SUV39H2. |
Rabbit anti-SUV39H2 Polyclonal Antibody
Applications | ChIP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SUV39H2 |
Rabbit Polyclonal Anti-SUV39H2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SUV39H2 antibody: synthetic peptide directed towards the middle region of human SUV39H2. Synthetic peptide located within the following region: LDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRT |
SUV39H2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SUV39H2 |