Antibodies

Jump to Filters
View as table Download
GST3 (GSTP1) Rabbit Polyclonal Antibody
TA350040

USD 380.00

In Stock

Rabbit Polyclonal Anti-GSTP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GSTP1
GST3 (GSTP1) Rabbit Polyclonal Antibody
TA308806

USD 625.00

5 Days

Rabbit polyclonal antibody to glutathione transferase (glutathione S-transferase pi 1)

Applications IF, IHC, WB
Reactivities Human (Predicted: Rat, Dog, Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 63 of GSTP1 (Uniprot ID#P09211)
GST3 (GSTP1) Rabbit Polyclonal Antibody
TA306508

USD 570.00

5 Days

Rabbit Polyclonal GSTP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GSTP1 antibody was raised against a 14 amino acid peptide from near the center of human GSTP1.
GST3 (GSTP1) Rabbit Polyclonal Antibody
TA324758

USD 580.00

5 Days

Rabbit polyclonal GSTP1 Antibody (C-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GSTP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 165-192 amino acids from the C-terminal region of human GSTP1.
GST3 (GSTP1) Rabbit Polyclonal Antibody
TA346676

USD 539.00

5 Days

Rabbit Polyclonal Anti-GSTP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSTP1 antibody is: synthetic peptide directed towards the N-terminal region of Human GSTP1. Synthetic peptide located within the following region: TVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQ
GST3 (GSTP1) Rabbit Polyclonal Antibody
AP02100SU-N

USD 415.00

2 Weeks

GST3 (GSTP1) rabbit polyclonal antibody, Serum

Applications ELISA, R, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Human Glutathion S-Transferase pi
GST3 (GSTP1) Rabbit Polyclonal Antibody
AP02100SU-S

USD 150.00

2 Weeks

GST3 (GSTP1) rabbit polyclonal antibody, Serum

Applications ELISA, R, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Human Glutathion S-Transferase pi
GST3 (GSTP1) (C-term) Rabbit Polyclonal Antibody
AP23405PU-N

USD 560.00

2 Weeks

GST3 (GSTP1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A peptide mapping at the C-terminus of GSTpi of human origin
GST3 (GSTP1) Rabbit Polyclonal Antibody
TA332845

USD 365.00

3 Weeks

Rabbit anti-GSTP1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GSTP1
GST3 (GSTP1) Goat Polyclonal Antibody
TA302504

USD 520.00

5 Days

Goat Polyclonal Antibody against GST3 / GSTP1

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-LADQGQSWKEEV, from the internal region of the protein sequence according to NP_000843.1.