Antibodies

View as table Download

Eph receptor A6 (EPHA6) (C-term) rabbit polyclonal antibody

Applications ELISA, IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EPHA6 antibody was raised against synthetic peptide - KLH conjugated

Rabbit polyclonal anti-EPHA6 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHA6.

Rabbit Polyclonal Anti-EPHA6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPHA6 antibody is: synthetic peptide directed towards the N-terminal region of Human EPHA6. Synthetic peptide located within the following region: DTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTG