Rabbit Polyclonal Anti-SRGAP3 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SRGAP3 |
Rabbit Polyclonal Anti-SRGAP3 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SRGAP3 |
Rabbit Polyclonal Anti-SRGAP3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRGAP3 antibody is: synthetic peptide directed towards the N-terminal region of Human SRGAP3. Synthetic peptide located within the following region: SSVKKIEKMKEKRQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDV |
SRGAP3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SRGAP3 |