Rabbit Polyclonal Anti-ARG2 Antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARG2 antibody: synthetic peptide directed towards the C terminal of human ARG2. Synthetic peptide located within the following region: SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT |
Rabbit polyclonal anti-ARG2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ARG2. |
Rabbit Polyclonal Anti-ARG2 Antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARG2 antibody: synthetic peptide directed towards the N terminal of human ARG2. Synthetic peptide located within the following region: LSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH |
Germany
Japan
United Kingdom
China
