Rabbit Polyclonal antibody to PCBP2 (poly(rC) binding protein 2)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Pig, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 193 of PCBP2 (Uniprot ID#Q15366) |
Rabbit polyclonal antibody to PCBP2 (poly(rC) binding protein 2)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Xenopus, Pig, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 302 and 365 of PCBP2 (Uniprot ID#Q15366) |
Rabbit Polyclonal Anti-PCBP2 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCBP2 antibody: synthetic peptide directed towards the middle region of human PCBP2. Synthetic peptide located within the following region: VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ |
Rabbit Polyclonal Anti-PCBP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCBP2 antibody: synthetic peptide directed towards the N terminal of human PCBP2. Synthetic peptide located within the following region: KKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLE |
Germany
Japan
United Kingdom
China
