Rabbit polyclonal Anti-PSMD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD1 antibody: synthetic peptide directed towards the N terminal of human PSMD1. Synthetic peptide located within the following region: HYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE |
Rabbit polyclonal Anti-PSMD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD1 antibody: synthetic peptide directed towards the N terminal of human PSMD1. Synthetic peptide located within the following region: DLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETE |
Germany
Japan
United Kingdom
China