Rabbit Polyclonal Anti-OR6M1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR6M1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6M1. Synthetic peptide located within the following region: KINFLLSALVILSSLAFTTGSYVYIISTILRIPSTQGRQKAFSTCASHIT |
Rabbit Polyclonal Anti-OR6M1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR6M1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6M1. Synthetic peptide located within the following region: SNIFVYVRPNQNSSLDYDKVAAVLITVVTPLLNPFIYSLRNEKVQEVLRE |
Germany
Japan
United Kingdom
China