Antibodies

Jump to Filters
View as table Download
OR5I1 Rabbit Polyclonal Antibody
TA315105

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR5I1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR5I1.
OR5I1 Rabbit Polyclonal Antibody
TA332029

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR5I1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR5I1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR5I1. Synthetic peptide located within the following region: SYLYSPNTDKIISVFYTIFIPVLNPLIYSLRNKDVKDAAEKVLRSKVDSS