Antibodies

Jump to Filters
View as table Download
OR51A7 Rabbit Polyclonal Antibody
TA316040

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR51A7 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR51A7.
OR51A7 Rabbit Polyclonal Antibody
TA332310

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR51A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR51A7 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR51A7. Synthetic peptide located within the following region: IPFPFTLRRLKYCQKNLLSHSYCLHQDTMKLACSDNKTNVIYGFFIALCT