Antibodies

Jump to Filters
View as table Download
OR2M2 Rabbit Polyclonal Antibody
TA316447

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR2M2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2M2.
OR2M2 Rabbit Polyclonal Antibody
TA337492

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR2M2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2M2 antibody is: synthetic peptide directed towards the middle region of Human OR2M2. Synthetic peptide located within the following region: YYGAALFMYIRPTSDHSPTQDKMVSVFYTILTPMLNPLIYSLRNKEVTRA
OR2M2 Rabbit Polyclonal Antibody
TA337493

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR2M2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2M2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2M2. Synthetic peptide located within the following region: DKMVSVFYTILTPMLNPLIYSLRNKEVTRAFMKILGKGKSESELPHKLYV
OR2M2 Rabbit Polyclonal Antibody
TA342718

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR2M2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR2M2 antibody: synthetic peptide directed towards the C terminal of human OR2M2. Synthetic peptide located within the following region: KEVTRAFMKILGKGKSESELPHKLYVLLFAKFFFLISIFFYDVKILALIM