Antibodies

Jump to Filters
View as table Download
OR2A7 Rabbit Polyclonal Antibody
TA316453

USD 380.00

In Stock

Rabbit polyclonal anti-OR2A4/2A7 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2A4/2A7.
OR2A7 Rabbit Polyclonal Antibody
TA337484

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR2A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2A7 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2A7. Synthetic peptide located within the following region: MYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLICSLRNSEVKNTLKRVLGV