Rabbit Polyclonal anti-OR13C9 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of human OR13C9. Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR |
Rabbit Polyclonal anti-OR13C9 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of human OR13C9. Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR |
Germany
Japan
United Kingdom
China
