Antibodies

Jump to Filters
View as table Download
OR10A6 Rabbit Polyclonal Antibody
TA316416

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR10A6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10A6.
OR10A6 Rabbit Polyclonal Antibody
TA332324

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR10A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10A6 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10A6. Synthetic peptide located within the following region: HLTSVTLFYGTASMTYLQPKSGYSPETKKVMSLSYSLLTPLLNLLIYSLR
OR10A6 Rabbit Polyclonal Antibody
TA332325

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR10A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10A6 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10A6. Synthetic peptide located within the following region: LSYIRVLFAILKMPSTTGRQKAFSTCAAHLTSVTLFYGTASMTYLQPKSG