Rabbit Polyclonal Anti-SGCB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGCB antibody: synthetic peptide directed towards the middle region of human SGCB. Synthetic peptide located within the following region: FSTDYETHEFHLPSGVKSLNVQKASTERITSNATSDLNIKVDGRAIVRGN |
Rabbit Polyclonal Anti-SGCB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGCB antibody is: synthetic peptide directed towards the middle region of Human SGCB. Synthetic peptide located within the following region: RIGPNGCDSMELHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN |
Germany
Japan
United Kingdom
China
