Antibodies

Jump to Filters
View as table Download
PDGFC Rabbit Polyclonal Antibody
TA310075

USD 360.00

3 Weeks

Rabbit anti-PDGFC polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen peptide coupled to KLH
PDGFC Rabbit Polyclonal Antibody
TA310120

USD 360.00

3 Weeks

Rabbit anti-PDGFC polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Partial recombaint protein
PDGFC Rabbit Polyclonal Antibody
TA343169

USD 539.00

5 Days

Rabbit Polyclonal Anti-PDGFC Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFC antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFC. Synthetic peptide located within the following region: CTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPS