Antibodies

Jump to Filters
View as table Download
CDC25B Rabbit Polyclonal Antibody
TA350823

USD 380.00

In Stock

Rabbit Polyclonal Anti-CDC25B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDC25B
CDC25B Rabbit Polyclonal Antibody
TA346009

USD 539.00

5 Days

Rabbit Polyclonal Anti-CDC25B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE
CDC25B Rabbit Polyclonal Antibody
TA330366

USD 539.00

5 Days

Rabbit Polyclonal Anti-CDC25B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASS
CDC25B Rabbit Polyclonal Antibody
TA313189

USD 380.00

In Stock

Rabbit polyclonal CDC25B (Ser323) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CDC25B around the phosphorylation site of serine 323 (S-P-SP-M-P).
Modifications Phospho-specific
CDC25B Rabbit Polyclonal Antibody
TA325330

USD 380.00

In Stock

Rabbit Polyclonal CDC25B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25B
CDC25B Rabbit Polyclonal Antibody
TA325331

USD 380.00

In Stock

Rabbit Polyclonal CDC25B (Ser323) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25B around the phosphorylation site of Serine 323
Modifications Phospho-specific
CDC25B Rabbit Polyclonal Antibody
TA325329

USD 380.00

2 Weeks

Rabbit Polyclonal CDC25B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25B
CDC25B Rabbit Polyclonal Antibody
TA325332

USD 380.00

4 Weeks

Rabbit Polyclonal CDC25B (Ser353) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25B around the phosphorylation site of Serine 353
Modifications Phospho-specific