Goat Anti-MRP8 / ABCC11 Antibody
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KVVEFDRPEVLRK, from the internal region (near C Terminus) of the protein sequence according to NP_115972.2; NP_660187.1. |
Rabbit Polyclonal Anti-ABCC11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCC11 Antibody: synthetic peptide directed towards the middle region of human ABCC11. Synthetic peptide located within the following region: NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH |
Germany
Japan
United Kingdom
China