Antibodies

View as table Download

Rabbit polyclonal Cytochrome P450 17A1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 17A1.

Rabbit polyclonal anti-CYP21A2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human CYP21A2.

Rabbit Polyclonal Anti-CYP11B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the middle region of human CYP11B1. Synthetic peptide located within the following region: LALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPK

Rabbit Polyclonal Anti-AKR1D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1D1 antibody: synthetic peptide directed towards the middle region of human AKR1D1. Synthetic peptide located within the following region: YVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGL

Rabbit Polyclonal Anti-HSD11B2 Antibody

Applications WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD11B2 antibody: synthetic peptide directed towards the N terminal of human HSD11B2. Synthetic peptide located within the following region: ERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRL