Rabbit polyclonal anti-OR8H3 antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR8H3. |
Rabbit polyclonal anti-OR8H3 antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR8H3. |
Rabbit Polyclonal Anti-OR8H3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR8H3 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR8H3. Synthetic peptide located within the following region: LKPRKSYSLGRDQVAPVFYTIVIPMLNPLIYSLRNREVKNALIRVMQRRQ |