Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 142 results

Page 1 of 10

(reset)

BIRC5 Rabbit Polyclonal Antibody

TA301775

USD 550.00

5 Days

Rabbit Polyclonal Antibody against Survivin - Astrocyte Marker

Applications	ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities	Human, Mouse, Rat, Feline, Dog
Conjugation	Unconjugated
Immunogen	Full-length recombinant human survivin.

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Caspase 9 (CASP9) Rabbit Polyclonal Antibody

TA312629

USD 380.00

In Stock

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human Caspase 9.

1 / 2

2 / 2

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA336686

USD 550.00

5 Days

Rabbit Polyclonal c-Myc Antibody

Applications	ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA329140

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

BCL2 Rabbit Polyclonal Antibody

TA323608

USD 380.00

2 Weeks

Anti-BCL2 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 41-54 amino acids of Human B-cell CLL/lymphoma 2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA307883

USD 625.00

5 Days

Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))

Applications	FC, IF, WB
Reactivities	Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey)
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106)

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA327567

USD 365.00

3 Weeks

Rabbit anti-TP53 Polyclonal Antibody

Applications	ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human TP53

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

MSH3 Rabbit Polyclonal Antibody

TA323011

USD 380.00

4 Weeks

Anti-MSH3 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a C terminal 300 amino acids of human mutS homolog 3 (E. coli)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Caspase 9 (CASP9) Rabbit Polyclonal Antibody

TA336326

USD 450.00

5 Days

Rabbit Polyclonal Caspase-9 Antibody

Applications	FC, ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat, Canine, Gerbil
Conjugation	Unconjugated
Immunogen	Recombinant catalytically active human Caspase-9 protein was used as immunogen (NP_001220).

1 / 3

2 / 3

3 / 3

Previous Next

Caspase 9 (CASP9) Rabbit Polyclonal Antibody

TA336327

USD 450.00

5 Days

Rabbit Polyclonal Caspase-9 Antibody

Applications	ICC/IF, IHC, IP, Simple Western, WB
Reactivities	Human, Mouse, Rat, Canine, Gerbil
Conjugation	Unconjugated
Immunogen	Recombinant full-length human Caspase-9 protein (pro-form) was used as an immunogen (NP_001220).

1 / 3

2 / 3

3 / 3

Previous Next

Cyclin D1 (CCND1) Rabbit Polyclonal Antibody

AP20500PU-N

USD 465.00

3 Weeks

Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1.

Caspase 9 (CASP9) Rabbit Polyclonal Antibody

TA321309

USD 380.00

In Stock

Anti-CASP9 (active) Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 41-56 amino acids of human caspase 9, apoptosis-related cysteine peptidase

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cyclin D1 (CCND1) Rabbit Polyclonal Antibody

TA321926

USD 380.00

In Stock

Anti-CCND1 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

BIRC5 Rabbit Polyclonal Antibody

TA323463

USD 380.00

In Stock

Anti-BIRC5 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Full length fusion protein

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA329141

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

1 - 15 of 142 results

Page 1 of 10