Antibodies

Jump to Filters
View as table Download
MARK3 Rabbit Polyclonal Antibody
TA311991

USD 380.00

In Stock

Rabbit polyclonal anti-MARK3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human MARK3.
MARK3 Rabbit Polyclonal Antibody
TA337660

USD 539.00

5 Days

Rabbit Polyclonal Anti-MARK3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MARK3 antibody: synthetic peptide directed towards the middle region of human MARK3. Synthetic peptide located within the following region: ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD