Antibodies

Jump to Filters
View as table Download
Aromatase (CYP19A1) Rabbit Polyclonal Antibody
TA311724

USD 380.00

2 Weeks

Rabbit polyclonal Cytochrome P450 19A1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 19A1.
Aromatase (CYP19A1) Rabbit Polyclonal Antibody
AP20542PU-N

USD 465.00

3 Weeks

Aromatase (CYP19A1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Aromatase (CYP19A1) Rabbit Polyclonal Antibody
TA321053

USD 380.00

In Stock

Anti-ARO Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 240-255 amino acids of Human Aromatase
Aromatase (CYP19A1) Rabbit Polyclonal Antibody
TA321054

USD 380.00

In Stock

Anti-ARO Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 240-255 amino acids of Human Aromatase
CYP11B1 Rabbit Polyclonal Antibody
TA342857

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP11B1 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL
CYP11B1 Rabbit Polyclonal Antibody
TA349847

USD 380.00

In Stock

Rabbit Polyclonal Anti-CYP11B1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP11B1
Aromatase (CYP19A1) Rabbit Polyclonal Antibody
TA301409

USD 550.00

In Stock

Rabbit Polyclonal Antibody against Aromatase

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human aromatase protein sequence (between residues 400-502).
Aromatase (CYP19A1) (475-486) Goat Polyclonal Antibody
AP22508PU-N

USD 555.00

2 Weeks

Aromatase (CYP19A1) (475-486) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide from internal region of human CYP19A1
CYP11B1 Rabbit Polyclonal Antibody
TA313736

USD 380.00

In Stock

Rabbit polyclonal Cytochrome P450 11B1/2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Cytochrome P450 11B1/2.
Aromatase (CYP19A1) Goat Polyclonal Antibody
TA302418

USD 520.00

5 Days

Goat Polyclonal Antibody against Aromatase / CYP19A1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HDLSLHPDETKN, from the internal region of the protein sequence according to NP_000094.2; NP_112503.1.
CYP11B1 Rabbit Polyclonal Antibody
TA342858

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP11B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the middle region of human CYP11B1. Synthetic peptide located within the following region: LALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPK