Antibodies

View as table Download

Rabbit Polyclonal CCR2 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of the human CCR2 protein (within residues 20-100). [Swiss-Prot# P00338]

Rabbit Polyclonal Anti-CCR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCR2

Rabbit Polyclonal CCR2 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal Anti-CCR2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCR2 antibody: synthetic peptide directed towards the middle region of human CCR2. Synthetic peptide located within the following region: LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL

Rabbit Polyclonal Anti-CCR2 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen CCR2 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human CCR2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (95%); Monkey (90%).

CCR2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated