Anti-YBX1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 310-324 amino acids of human Y box binding protein 1 |
Anti-YBX1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 310-324 amino acids of human Y box binding protein 1 |
Anti-YBX1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 310-324 amino acids of human Y box binding protein 1 |
Rabbit Polyclonal Anti-YBX1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-YBX1 Antibody: synthetic peptide directed towards the middle region of human YBX1. Synthetic peptide located within the following region: NHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRR |
Rabbit polyclonal YBX1 Antibody (C-term)
Applications | IF, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine, Xenopus) |
Conjugation | Unconjugated |
Immunogen | This YBX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 276-305 amino acids from the C-terminal region of human YBX1. |
Rabbit polyclonal YBX1 Antibody (Center)
Applications | IF, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine, Rabbit) |
Conjugation | Unconjugated |
Immunogen | This YBX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 149-178 amino acids from the Central region of human YBX1. |
Rabbit Polyclonal YB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the entire range of the protein (CAA65446). |
Rabbit Polyclonal Anti-NSEP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NSEP1 Antibody: synthetic peptide directed towards the C terminal of human NSEP1. Synthetic peptide located within the following region: NMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNF |
Rabbit Polyclonal Anti-YBX1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-YBX1 antibody is: synthetic peptide directed towards the C-terminal region of Human YBX1. Synthetic peptide located within the following region: PYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPP |
Rabbit polyclonal YB1 (Ser102) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human YB1 around the phosphorylation site of serine 102 (L-R-SP-V-G). |
Modifications | Phospho-specific |