Antibodies

Jump to Filters
View as table Download
CD95 (FAS) Rabbit Polyclonal Antibody
TA337864

USD 539.00

5 Days

Rabbit Polyclonal Anti-FAIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD
CD95 (FAS) Rabbit Polyclonal Antibody
TA354221

USD 425.00

5 Days

Rabbit anti CD95 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated