Antibodies

Jump to Filters
View as table Download
Retinoid X Receptor alpha (RXRA) Rabbit Polyclonal Antibody
TA334734

USD 539.00

5 Days

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRA antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: GPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF
Retinoid X Receptor alpha (RXRA) Goat Polyclonal Antibody
TA302967

USD 520.00

In Stock

Goat Polyclonal Antibody against RXRA

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence CQVNSSLTSPTGRGSM, from the internal region of the protein sequence according to NP_002948.1.