Antibodies

Jump to Filters
View as table Download
Profilin 1 (PFN1) Rabbit Polyclonal Antibody
TA309799

USD 550.00

5 Days

Rabbit Polyclonal Profilin 1 Antibody

Applications IHC, Simple Western, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human protein (within residues 100-140). [Swiss-Prot# P07737]
Profilin 1 (PFN1) Rabbit Polyclonal Antibody
TA346593

USD 539.00

5 Days

Rabbit Polyclonal Anti-PFN1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PFN1 antibody: synthetic peptide directed towards the N terminal of human PFN1. Synthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL
Profilin 1 (PFN1) Rabbit Polyclonal Antibody
TA322682

USD 380.00

In Stock

Anti-PFN1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-140 amino acids of human profilin 1
Profilin 1 (PFN1) Rabbit Polyclonal Antibody
TA350722

USD 380.00

In Stock

Rabbit Polyclonal Anti-PFN1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PFN1
Profilin 1 (PFN1) Rabbit Polyclonal Antibody
TA326963

USD 365.00

3 Weeks

PFN1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human PFN1