Antibodies

Jump to Filters
View as table Download
OR5L2 (N-term) Rabbit Polyclonal Antibody
AP53093PU-N

USD 580.00

2 Weeks

OR5L2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human OR5L2
OR5L2 Rabbit Polyclonal Antibody
TA337533

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR5L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR5L2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5L2. Synthetic peptide located within the following region: YCRPSSGNSGDVDKVATVFYTVVIPMLNPLIYSLRNKDVNKALRKVMGSK