Antibodies

Jump to Filters
View as table Download
OR2W3 (C-term) Rabbit Polyclonal Antibody
AP53043PU-N

USD 580.00

2 Weeks

OR2W3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 293-314 amino acids from the C-terminal region of human Olfactory receptor 2W3
OR2W3 Rabbit Polyclonal Antibody
TA316367

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR2W3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2W3.
OR2W3 Rabbit Polyclonal Antibody
TA337498

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR2W3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2W3 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2W3. Synthetic peptide located within the following region: IIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGALGRL