Antibodies

Jump to Filters
View as table Download
DOLPP1 Rabbit Polyclonal Antibody
TA338419

USD 539.00

5 Days

Rabbit Polyclonal Anti-DOLPP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DOLPP1 antibody: synthetic peptide directed towards the N terminal of human DOLPP1. Synthetic peptide located within the following region: AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI
DOLPP1 Rabbit Polyclonal Antibody
TA362460

USD 539.00

5 Days

DOLPP1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human DOLPP1