Antibodies

Jump to Filters
View as table Download
MLH3 Rabbit Polyclonal Antibody
TA315357

USD 380.00

In Stock

Rabbit polyclonal anti-MLH3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MLH3.
MLH3 Rabbit Polyclonal Antibody
TA346484

USD 539.00

5 Days

Rabbit Polyclonal Anti-MLH3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MLH3 antibody: synthetic peptide directed towards the middle region of human MLH3. Synthetic peptide located within the following region: SMQVLQQVDNKFIACLMSTKTEENGEADSYEKQQAQGSGRKKLLSSTLIP