Antibodies

Jump to Filters
View as table Download
GALK2 Rabbit Polyclonal Antibody
TA331254

USD 539.00

5 Days

Rabbit Polyclonal Anti-GALK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GALK2 antibody is: synthetic peptide directed towards the C-terminal region of Human GALK2. Synthetic peptide located within the following region: TVSMVPADKLPSFLANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLE
GALK2 Rabbit Polyclonal Antibody
TA362333

USD 539.00

5 Days

GALK2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GALK2