Antibodies

View as table Download

Rabbit Polyclonal Anti-MAPK12 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAPK12

Rabbit polyclonal Anti-MAPK12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAPK12 antibody: synthetic peptide directed towards the N terminal of human MAPK12. Synthetic peptide located within the following region: SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE