Antibodies

Jump to Filters
View as table Download
SV2A Rabbit Polyclonal Antibody
TA322365

USD 380.00

4 Weeks

Anti-SV2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 21-35 amino acids of human synaptic vesicle glycoprotein 2A
SV2A Rabbit Polyclonal Antibody
TA341964

USD 539.00

5 Days

Rabbit Polyclonal Anti-SV2A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SV2A antibody: synthetic peptide directed towards the middle region of human SV2A. Synthetic peptide located within the following region: LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT