PDGF beta (PDGFB) (222-233) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Bovine, Sheep |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from C-Terminus of human PDGFB (NP_002599.1; NP_148937.1) |
PDGF beta (PDGFB) (222-233) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Bovine, Sheep |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from C-Terminus of human PDGFB (NP_002599.1; NP_148937.1) |
Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TUBB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TUBB4 antibody: synthetic peptide directed towards the N terminal of human TUBB4. Synthetic peptide located within the following region: TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI |
Rabbit Polyclonal Anti-TUBB2A Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the N terminal of human TUBB2A. Synthetic peptide located within the following region: MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV |
Rabbit Polyclonal Antibody against CDC2 (T14)
Applications | IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, Xenopus) |
Conjugation | Unconjugated |
Immunogen | This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1. |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 494.00
3 Weeks
purified EGFR biotinylated mouse monoclonal detection antibody, validated for Luminex assays
Applications | ELISA |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600469, TA600472 |
Mouse Monoclonal Anti-alpha-Tubulin Antibody [2B11]
Applications | WB |
Reactivities | Human, Mouse, Rat, Rabbit, Zebrafish |
Conjugation | Unconjugated |
USD 875.00
2 Weeks
Dopamine D2 Receptor (DRD2) (long isoform, 243-254) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | D2L (243-254) cyclized covalently attached to a carrier protein. |
Mouse Monoclonal GRB2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |