Antibodies

Jump to Filters
View as table Download
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA332982

USD 365.00

2 Weeks

Rabbit anti-UGT1A1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A1
Steroid sulfatase (STS) Rabbit Polyclonal Antibody
TA346177

USD 539.00

5 Days

Rabbit Polyclonal Anti-STS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STS antibody: synthetic peptide directed towards the middle region of human STS. Synthetic peptide located within the following region: EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY
HSD11B1 Goat Polyclonal Antibody
TA302508

USD 520.00

5 Days

Goat Polyclonal Antibody against HSD11B1 / HDL

Applications WB
Reactivities Human (Expected from sequence similarity: Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence CTSYNMDRFINK, from the C Terminus of the protein sequence according to NP_005516.1; NP_861420.1.
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA335239

USD 539.00

5 Days

Rabbit Polyclonal Anti-UGT1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the N terminal of human UGT1A1. Synthetic peptide located within the following region: DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR