Antibodies

Jump to Filters
View as table Download
CYP8B1 Rabbit Polyclonal Antibody
TA313734

USD 380.00

2 Weeks

Rabbit polyclonal Cytochrome P450 8B1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1.
ACSL3 Rabbit Polyclonal Antibody
TA339415

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ACSL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI
FACL4 (ACSL4) Rabbit Polyclonal Antibody
TA324720

USD 580.00

2 Weeks

Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4).
SCD1 (SCD) Mouse Monoclonal Antibody [Clone ID: CD.E10]
TA309938

USD 380.00

2 Weeks

Mouse anti-SCD1 (Stearoyl-CoA desaturase) monoclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
TA309938 is a replacement of AM20836PU-N.
CPT1A Goat Polyclonal Antibody
TA303144

USD 520.00

2 Weeks

Goat Polyclonal Antibody against CPT1A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPAQTVEQRLKLFK, from the internal region of the protein sequence according to NP_001867.2; NP_001027017.1.