Germany
Japan
United Kingdom
China
FN1 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Antibodies
View as table DownloadUSD 200.00
2 Days
VWF mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal anti-LAMC1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMC1. |
Von Willebrand Factor (VWF) goat polyclonal antibody, Purified
| Applications | ELISA, Ie, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Human von Willebrand Factor (vWF) purified from plasma |
Rabbit Polyclonal Anti-SV2A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SV2A antibody: synthetic peptide directed towards the middle region of human SV2A. Synthetic peptide located within the following region: LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT |
Rabbit Polyclonal Anti-Osteopontin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Osteopontin Antibody: A synthesized peptide derived from human Osteopontin |
Active filters
Reactivities
- Human
Families
- Secreted Protein
Pathways
- ECM-receptor interaction
Citations
- Yes