Antibodies

View as table Download

Rabbit Polyclonal Anti-WNT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT2

Rabbit polyclonal anti-CKI-a antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-a.

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Chicken
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT