Antibodies

Jump to Filters
View as table Download
MC1 Receptor (MC1R) Rabbit Polyclonal Antibody
TA308794

USD 625.00

In Stock

Rabbit polyclonal antibody to MC1R (melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor))

Applications IHC, WB
Reactivities Human (Predicted: Chicken, Chimpanzee)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 253 and 317 of MC1 Receptor (Uniprot ID#Q01726)
MC1 Receptor (MC1R) Rabbit Polyclonal Antibody
TA343283

USD 539.00

5 Days

Rabbit Polyclonal Anti-MC1R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MC1R antibody is: synthetic peptide directed towards the C-terminal region of MC1R. Synthetic peptide located within the following region: CPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCS