Antibodies

View as table Download

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)

Rabbit Polyclonal Anti-CCL18 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL18 antibody: synthetic peptide directed towards the middle region of human CCL18. Synthetic peptide located within the following region: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)