Antibodies

Jump to Filters
View as table Download
RUNX3 Rabbit Polyclonal Antibody
TA322762

USD 380.00

4 Weeks

Anti-RUNX3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 400-415 amino acids of human runt-related transcription factor 3
RUNX3 Rabbit Polyclonal Antibody
TA342336

USD 485.00

5 Days

Rabbit Polyclonal Anti-RUNX3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RUNX3 antibody: synthetic peptide directed towards the C terminal of mouse RUNX3. Synthetic peptide located within the following region: PYPGAPQSQSGPFQANPAPYHLFYGASSGSYQFSMAAAGGGERSPTRMLT