Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 8 of 8 results

(reset)

RDH11 Mouse Monoclonal Antibody [Clone ID: OTI1B4]

TA501053

USD 447.00

In Stock

Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

RDH11 Mouse Monoclonal Antibody [Clone ID: OTI1B4]

CF501053

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

RDH11 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B4]

TA501053AM

USD 509.00

2 Weeks

Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

RDH11 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B4]

TA501053BM

USD 509.00

2 Weeks

Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

RDH11 Mouse Monoclonal Antibody [Clone ID: OTI1B4]

TA501053S

USD 200.00

In Stock

Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

RDH11 Rabbit Polyclonal Antibody

TA350339

USD 380.00

In Stock

Rabbit Polyclonal Anti-RDH11 Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human RDH11

1 / 2

2 / 2

Previous Next

RDH11 Rabbit Polyclonal Antibody

TA346621

USD 539.00

5 Days

Rabbit Polyclonal Anti-RDH11 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-RDH11 antibody: synthetic peptide directed towards the C terminal of human RDH11. Synthetic peptide located within the following region: SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR

RDH11 Rabbit Polyclonal Antibody

TA380824

USD 365.00

3 Weeks

RDH11 Rabbit polyclonal Antibody

Applications	WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human RDH11.

1 - 8 of 8 results