Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-RDH11 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RDH11 |
Rabbit Polyclonal Anti-RDH11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RDH11 antibody: synthetic peptide directed towards the C terminal of human RDH11. Synthetic peptide located within the following region: SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR |
RDH11 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RDH11. |