Antibodies

Jump to Filters
View as table Download
PLEKHG3 (C-term) Rabbit Polyclonal Antibody
AP53350PU-N

USD 580.00

2 Weeks

PLEKHG3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1185-1214 amino acids from the C-terminal region of human PLEKHG3
PLEKHG3 Rabbit Polyclonal Antibody
TA331945

USD 539.00

5 Days

Rabbit Polyclonal Anti-PLEKHG3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLEKHG3 Antibody is: synthetic peptide directed towards the C-terminal region of Human PLEKHG3. Synthetic peptide located within the following region: PGGRPSARSPLSPTETFSWPDVRELCSKYASRDEARRAGGGRPRGPPVNR