Antibodies

Jump to Filters
View as table Download
Annexin VII (ANXA7) Mouse Monoclonal Antibody [Clone ID: OTI1C3]
TA504925

USD 447.00

In Stock

ANXA7 (Annexin VII) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Annexin VII (ANXA7) Mouse Monoclonal Antibody [Clone ID: OTI1C3]
CF504925

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) ANXA7 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Annexin VII (ANXA7) Rabbit Polyclonal Antibody
TA308796

USD 625.00

5 Days

Rabbit polyclonal antibody to Annexin VII (annexin A7)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 122 and 459 of Annexin VII (Uniprot ID#P20073)
Annexin VII (ANXA7) Rabbit Polyclonal Antibody
TA325068

USD 580.00

5 Days

Rabbit polyclonal ANXA7 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human (Predicted: Mouse, Bovine, Monkey)
Conjugation Unconjugated
Immunogen This ANXA7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 329-356 amino acids from the Central region of human ANXA7.
Annexin VII (ANXA7) Rabbit Polyclonal Antibody
TA590070

USD 482.00

In Stock

Rabbit Polyclonal Annexin A7 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
Annexin VII (ANXA7) Rabbit Polyclonal Antibody
TA321292

USD 380.00

In Stock

Anti-ANXA7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 232 amino acids of Human Annexin A7
Annexin VII (ANXA7) Rabbit Polyclonal Antibody
TA321293

USD 380.00

In Stock

Anti-ANXA7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 232 amino acids of Human Annexin A7
Annexin VII (ANXA7) Rabbit Polyclonal Antibody
TA341653

USD 485.00

5 Days

Rabbit Polyclonal Anti-ANXA7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA7 antibody: synthetic peptide directed towards the N terminal of human ANXA7. Synthetic peptide located within the following region: MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP
Annexin VII (ANXA7) Rabbit Polyclonal Antibody
TA341654

USD 485.00

5 Days

Rabbit Polyclonal Anti-ANXA7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA7 antibody: synthetic peptide directed towards the N terminal of human ANXA7. Synthetic peptide located within the following region: GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMK