Germany
Japan
United Kingdom
China
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Carrier-free (BSA/glycerol-free) BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
BCL2A1 (BH3 Domain) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against a synthetic peptide selected from the N-terminal region of human BCL2-related protein A1, within the BH3 domain. |
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
BCL2A1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide |
BCL2A1 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to 14 amino acid peptide from near the carboxy terminus of human Bfl-1. |
Goat Anti-BCL2A1 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Dog, Cow, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NVVSVDTART, from the internal region of the protein sequence according to NP_004040.1; NP_001108207.1. |
Rabbit Polyclonal Anti-BCL2A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCL2A1 antibody: synthetic peptide directed towards the C terminal of human BCL2A1. Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY |
BCL2A1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to Human BCL2A1. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- BCL2A1