Antibodies

Jump to Filters
View as table Download
TIGD5 Rabbit Polyclonal Antibody
TA365194

USD 380.00

4 Weeks

TIGD5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TIGD5
Tigd5 Rabbit Polyclonal Antibody
TA333421

USD 539.00

5 Days

Rabbit Polyclonal Anti-Tigd5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Tigd5 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tigd5. Synthetic peptide located within the following region: PGSTARPPPPPAPGPRPRVAVKMTFRKAYSIKDKLQAIERVKGGERQASV